PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 389aa    MW: 43868.7 Da    PI: 9.4743
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1052genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.3e-093576148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd  l  av+++ g++Wk+I      g t+ qc +rwqk+l
      Gh_D12G1052 35 KGGWTEEEDNMLTIAVQKFNGKNWKKI------GITDVQCLHRWQKVL 76
                     688***********************4......58999*******986 PP

2Myb_DNA-binding56.94.7e-1882128148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+l+ ++v++ G++ W+ Ia+ ++ gR +kqc++rw ++l
      Gh_D12G1052  82 KGPWTKEEDDLIFELVEKQGKKKWSEIAKFLP-GRIGKQCRERWCNHL 128
                      79******************************.*************96 PP

3Myb_DNA-binding51.42.4e-16135176245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +WT +E+++l+ a+  +G++ W+ Ia+ ++ gRt++++k++w+
      Gh_D12G1052 135 TAWTVDEELILISAHGAYGNR-WAEIAKLLP-GRTENSIKNHWN 176
                      68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.9173076IPR017930Myb domain
SuperFamilySSF466899.33E-143390IPR009057Homeodomain-like
SMARTSM007174.9E-43478IPR001005SANT/Myb domain
PfamPF002496.4E-73576IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-153788IPR009057Homeodomain-like
PROSITE profilePS5129430.77577132IPR017930Myb domain
SuperFamilySSF466891.36E-3179175IPR009057Homeodomain-like
SMARTSM007171.2E-1781130IPR001005SANT/Myb domain
PfamPF002492.3E-1782128IPR001005SANT/Myb domain
CDDcd001671.19E-1584128No hitNo description
Gene3DG3DSA:1.10.10.606.7E-2789135IPR009057Homeodomain-like
SMARTSM007174.2E-16133181IPR001005SANT/Myb domain
PROSITE profilePS5129421.408133183IPR017930Myb domain
PfamPF002495.0E-15134177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-23136183IPR009057Homeodomain-like
CDDcd001671.46E-11136176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEQIATDNNT TTIDADQSTV SVQGRISGPT RRSTKGGWTE EEDNMLTIAV QKFNGKNWKK  60
IGITDVQCLH RWQKVLNPDL VKGPWTKEED DLIFELVEKQ GKKKWSEIAK FLPGRIGKQC  120
RERWCNHLNP DIKKTAWTVD EELILISAHG AYGNRWAEIA KLLPGRTENS IKNHWNSSVR  180
KKVDAMAASR INAVDHSPKA ECISLGISKP LEQNLDHGRS ISFFSMCKDA NGIMKPSSLN  240
ISIKRYEDLT IENCRVHSYD PLPRNRQMHS CDSRSHCNVT FGDHERITSQ CFLARMHAGS  300
SFQPSSDSLH APVSASCFRC SGNEIPDANS YISLESILRS AAKSFKNTPS IIRKRTSQIR  360
TQADNHNINQ LPLSPTKSPK LENKAHPRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-62351836159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-62351836159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435502.10.0PREDICTED: uncharacterized protein LOC105762143
TrEMBLA0A0D2T4I30.0A0A0D2T4I3_G
STRINGMLOC_10556.16e-81(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.25e-81myb domain protein 3r-4